PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000437717
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 375aa    MW: 42238.1 Da    PI: 9.558
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000437717genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-141562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed+ l +++  +G g W+  +++ g++R++k+c++rw++yl
    MDP0000437717 15 RGAWTAMEDKVLTEYIGNHGEGKWRNLPKRAGLKRCGKSCRLRWLNYL 62
                     89********************************************97 PP

2Myb_DNA-binding51.32.8e-1668111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T +E+el+++++k+lG++ W++Ia +++ gRt++++k++w++
    MDP0000437717  68 RGNITRDEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNT 111
                      7899******************.*********.***********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.6351062IPR017930Myb domain
SuperFamilySSF466894.21E-2713109IPR009057Homeodomain-like
SMARTSM007173.9E-111464IPR001005SANT/Myb domain
PfamPF002499.4E-131562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-221669IPR009057Homeodomain-like
CDDcd001678.23E-81762No hitNo description
PROSITE profilePS5129425.15263117IPR017930Myb domain
SMARTSM007172.8E-1567115IPR001005SANT/Myb domain
PfamPF002494.0E-1468111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2370116IPR009057Homeodomain-like
CDDcd001675.66E-1172113No hitNo description
SuperFamilySSF542362.3E-7302346IPR029071Ubiquitin-related domain
PfamPF041107.0E-10303342IPR007242Ubiquitin-like protein Atg12
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000045Biological Processautophagosome assembly
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MGRSPCCSKD EGLNRGAWTA MEDKVLTEYI GNHGEGKWRN LPKRAGLKRC GKSCRLRWLN  60
YLRPDIKRGN ITRDEEELII RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN TTIGKRIQVE  120
GRSCSDGNRR PTQEKPKPTL SPKPSTNISC TKVVRTKASR CTKVVLPHES QKFGYSTEQV  180
VNAAPTLNQA VNNPMVGIDE PLLPMSFLDD ENNNSCEFLV DFKMDENFLS DFLNVDFSVL  240
YNNEGAGKAA AAATTEDTSN KLHGPDLRSS KAPIIESELD CWLAFDRRSS AMATTESPGA  300
VKKVVVHLRA TGDAPILKQS KFKILGTDKF AKVIEFLRRQ LHKETLVNTK EFILQKQRER  360
EFSSIETSEQ VEIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-261311725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.148290.0fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744630.0DQ074463.1 Malus x domestica MYB11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001280958.10.0uncharacterized protein LOC103453608
TrEMBLQ2LME90.0Q2LME9_MALDO; MYB11
STRINGVIT_09s0002g01400.t011e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.13e-60myb domain protein 4